PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g009607m
Common NameCISIN_1g009607mg, LOC102608614
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRAS
Protein Properties Length: 532aa    MW: 58180.3 Da    PI: 5.4142
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g009607mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS408.94.9e-1251565171373
               GRAS   1 lvelLlecAeavssgdlelaqalLarlsel..aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                        lv+ L++cAe v+ g+++ a +l++ ++ l  + +    + ++a +f  AL+ r+++ + +++ +          +se+   ++ f+e++P+
  orange1.1g009607m 156 LVHMLMTCAESVQRGEMAVAGSLIEDMKGLltRVNPSCGIGKVAGCFIDALSFRIMGVGGSICGS----------VSENEILYHHFYEACPY 237
                        689*************************995444444789*****************66666532..........4555667899******* PP

               GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlv 182
                        lkf+h+taNqaIlea++g+++vH++Df++++GlQWpaL+qaLa Rp+gpp lR+Tg+g+p+++ +++l+e+g rLa++A++++++f f+ ++
  orange1.1g009607m 238 LKFAHFTANQAILEAFDGHDCVHVVDFNLMHGLQWPALIQALALRPGGPPLLRLTGIGPPSPDGRDSLREIGLRLAELARSVNIRFTFRGVA 329
                        ******************************************************************************************** PP

               GRAS 183 akrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak 274
                        a+rled+++++L+v+p+EalaVn++lqlh+ll ++ + +s+ + vL  +++l+Pk+++vveqe++hn+++Fl+rf+ al+yys++fdslea 
  orange1.1g009607m 330 ASRLEDVKPWMLQVSPKEALAVNSILQLHKLLGSDPARNSPMEMVLGWIRNLNPKIMTVVEQESNHNQPEFLDRFTTALYYYSTMFDSLEAC 421
                        *****************************************************************************************998 PP

               GRAS 275 lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrp 366
                             + ++ + + +l+rei+nvv+ceg++r+erhe l+kWr+rl  aGF+p++l+++a  qa++ll  ++ +gy+vee +g+l+lgW++rp
  orange1.1g009607m 422 ---PLQPEKALAEIYLQREICNVVCCEGSARVERHEPLAKWRNRLAGAGFRPLHLGSNAFRQASMLLTLFSAEGYSVEETEGCLTLGWHSRP 510
                        ...345566677778***************************************************************************** PP

               GRAS 367 LvsvSaW 373
                        L+++SaW
  orange1.1g009607m 511 LIAASAW 517
                        ******* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120411.4E-333197IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011297.2E-2531103No hitNo description
PROSITE profilePS5098562.687130498IPR005202Transcription factor GRAS
PfamPF035141.7E-122156517IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 532 aa     Download sequence    Send to blast
MVLYDSATSG GSNSGSSSSC SGTKQPVAEI DGLLAGAGYK VRSSELRQVA QRLERLETVM  60
VNSPADISQL ASDTVHYNPS DLASWVDSLL SEFNQPPLPL PSDLPDLPDI IAGPSVNHTA  120
VGNYLTDNFT TTQQQQQQQQ QMMIVTAMEE DSGIRLVHML MTCAESVQRG EMAVAGSLIE  180
DMKGLLTRVN PSCGIGKVAG CFIDALSFRI MGVGGSICGS VSENEILYHH FYEACPYLKF  240
AHFTANQAIL EAFDGHDCVH VVDFNLMHGL QWPALIQALA LRPGGPPLLR LTGIGPPSPD  300
GRDSLREIGL RLAELARSVN IRFTFRGVAA SRLEDVKPWM LQVSPKEALA VNSILQLHKL  360
LGSDPARNSP MEMVLGWIRN LNPKIMTVVE QESNHNQPEF LDRFTTALYY YSTMFDSLEA  420
CPLQPEKALA EIYLQREICN VVCCEGSARV ERHEPLAKWR NRLAGAGFRP LHLGSNAFRQ  480
ASMLLTLFSA EGYSVEETEG CLTLGWHSRP LIAASAWHAV PDVMMSHQNS N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-501565184375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.172410.0flower| fruit| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006475770.10.0PREDICTED: DELLA protein GAI
SwissprotQ9LQT81e-170GAI_ARATH; DELLA protein GAI
TrEMBLA0A067GKY10.0A0A067GKY1_CITSI; Uncharacterized protein
STRINGVIT_11s0016g04630.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM160451015
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.11e-147GRAS family protein